Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia africae Probable intracellular septation protein A (RAF_ORF0501)

Recombinant Rickettsia africae Probable intracellular septation protein A (RAF_ORF0501)

SKU:CSB-CF503888RMN

Regular price $1,848.00 USD
Regular price Sale price $1,848.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia africae (strain ESF-5)

Uniprot NO.:C3PNB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:RAF_ORF0501

Expression Region:1-180

Sequence Info:full length protein

View full details