Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1282030 (RCOM_1282030)

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1282030 (RCOM_1282030)

SKU:CSB-CF497504RMM

Regular price $1,822.00 USD
Regular price Sale price $1,822.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9SCX0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSEKTGEAKITIQEPKAADPKGKGIADAPPPPVVVTTAKAIQKLPRGGWKKGVAIFDFV VRLCAIATGLAATGIMGTTEQTLPFFTQFFQFHAEYNDLPTFMFFVFANGIASGYLILSL PFSIVCIVRPLAIVPRLLLIIFDTVVMALTIAAASAAAAIVYLAHNGNSNANWNAICQQF NDFCQQTSTAVVASFITAAMLTFLIVLSAFALKRN

Protein Names:Recommended name: Casparian strip membrane protein RCOM_1282030

Gene Names:ORF Names:RCOM_1282030

Expression Region:1-215

Sequence Info:full length protein

View full details