Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259250 (RCOM_1259250)

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259250 (RCOM_1259250)

SKU:CSB-CF497506RMM

Regular price $1,803.00 USD
Regular price Sale price $1,803.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9SX12

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTTIEIPAESSAVAKGKAPLIGASSSSYEKKGGYKKGIAIFDFILRLGAVISALSAAAT MGTSDETLPFFTQFFQFEAGYDDFPTFQFFVIAMGFVGGYLVLSLPFSVVAIIRPHAVGI RLLLLILDTVALTLNTAAAAAAAAIVYLAHNGNQSANWLAVCQQFGDFCQKVSGGVVASF VSVLVFLLLVVMSAVALRKH

Protein Names:Recommended name: Casparian strip membrane protein RCOM_1259250

Gene Names:ORF Names:RCOM_1259250

Expression Region:1-200

Sequence Info:full length protein

View full details