Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodospirillum rubrum UPF0059 membrane protein Rru_A0282(Rru_A0282)

Recombinant Rhodospirillum rubrum UPF0059 membrane protein Rru_A0282(Rru_A0282)

SKU:CSB-CF647811RMB

Regular price $1,864.00 USD
Regular price Sale price $1,864.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)

Uniprot NO.:Q2RXQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLATLTVLGFSLSADAFAAALGKGAGARRPDLLEAFRVGAYFGAFEAAAPLIGWALGLT FAARIAAFDHWVAFTLLAGVGGHMVIAALRAPKAETAEASKARQKRALSPLRLALAALAT SIDATAVGIGLAVTEVNILMACALIGAITTVVAAGGVLLGRGAGPLLGRKAEVLGGLALI GIGLKILIEHLSA

Protein Names:Recommended name: UPF0059 membrane protein Rru_A0282

Gene Names:Ordered Locus Names:Rru_A0282

Expression Region:1-193

Sequence Info:full length protein

View full details