Gene Bio Systems
Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)
Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)
SKU:CSB-CF505956RLK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Uniprot NO.:C0ZPH6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVARSLLLFVLAALLEIGGAWLVWQGIREHKGWIWVGLGVISLGLYGLVATMQPDANFG RILAAYGGIFVAGSLLWAVVMDGFRPDRFDIAGALICLVGVGVIMYAR
Protein Names:Recommended name: UPF0060 membrane protein RER_49640
Gene Names:Ordered Locus Names:RER_49640
Expression Region:1-108
Sequence Info:full length protein
