Recombinant Rhodobacter sphaeroides  Protein CrcB homolog(crcB)

Recombinant Rhodobacter sphaeroides Protein CrcB homolog(crcB)

CSB-CF664411RLF
Regular price
$1,092.00 USD
Sale price
$1,092.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3J5P3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISSLLQVALGGALGASARYLTNVGSMRLFGPAFPVGTMIVNVVGSFLMGVLVVVLAHKG NRYAPFLMTGMLGGFTTFSAFSLDAVTLYERGQAGLAAAYVGLSVGLSLAGLMAGMAAVR GWMA

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:RHOS4_03230 ORF Names:RSP_1744

Expression Region:1-124

Sequence Info:full length protein

Your list is ready to share