Gene Bio Systems
Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C(norC)
Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C(norC)
SKU:CSB-CF520888RLG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Uniprot NO.:O06844
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SEILTKSRARNVFYGGSLFFIAVFVGLTVQSHNYVVSTTPALTDEVILGKHVWERNSCIN CHTLHGEGAYFAPEVGNVMTRWGVLDDPDAAAEMLGGWMDAQPSGVEGRRQMPHFELTDE EKRGLSEFLRWADQMNTQSWPPNDAG
Protein Names:Recommended name: Nitric oxide reductase subunit C Alternative name(s): NOR small subunit Nitric oxide reductase cytochrome c subunit
Gene Names:Name:norC Ordered Locus Names:Rsph17025_0970
Expression Region:2-147
Sequence Info:full length protein
