Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG(rnfG)

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG(rnfG)

SKU:CSB-CF663091RLF

Regular price $1,825.00 USD
Regular price Sale price $1,825.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Uniprot NO.:Q3IXC2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDDTAAPPPRGPARDWKSSPLVSGLLLGLFSLVSALMLALASDATRGPIAARSAEDLLA SLAQVLPETLHDNDPTADIRTLSDADEGAVRVYVAARGGAVTAVTFELTGYGYGGAIRVL MAVAADGTILGARVLSHTETPGLGDKIEIGKDDWIEGFAGRSLTDPGPAGWKVRRDGGVF DQFSGATITPRAVVGTIHRGLTLFDRHRAELLAPLPPRS

Protein Names:Recommended name: Electron transport complex protein RnfG Alternative name(s): Nitrogen fixation protein RnfG

Gene Names:Name:rnfG Ordered Locus Names:RHOS4_32440 ORF Names:RSP_3196

Expression Region:1-219

Sequence Info:full length protein

View full details