Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizopus oryzae FK506-binding protein 2A(FKBP2)

Recombinant Rhizopus oryzae FK506-binding protein 2A(FKBP2)

SKU:CSB-CF314653RDE

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizopus oryzae (Rhizopus delemar)

Uniprot NO.:P0C1J4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE

Protein Names:Recommended name: FK506-binding protein 2A EC= 5.2.1.8 Alternative name(s): Peptidyl-prolyl cis-trans isomerase Short name= PPIase Rotamase

Gene Names:Name:FKBP2 Synonyms:fpr2 ORF Names:RO3G_06709

Expression Region:22-167

Sequence Info:full length protein

View full details