Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Uncharacterized protein y4jG (NGR_a03080)

Recombinant Rhizobium sp. Uncharacterized protein y4jG (NGR_a03080)

SKU:CSB-CF345480RKX

Regular price $1,596.00 USD
Regular price Sale price $1,596.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:P55507

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSALEDVRTVALPRDCVSTVQAHLRSVGQQGHEGMALWVGVQQDQHFVIAETVIPAQRHI RTSDGVCVMVPAEELHRLNVWLYKRGLTLLAQIHSHPGRAYHSTTDDAYAVATTIGCLSL VVPNFAREPFDFAHVAAYRLDAKANWNEVPSAVLTRMITITS

Protein Names:Recommended name: Uncharacterized protein y4jG

Gene Names:Ordered Locus Names:NGR_a03080 ORF Names:y4jG

Expression Region:1-162

Sequence Info:full length protein

View full details