Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Uncharacterized protein y4fD (NGR_a03770)

Recombinant Rhizobium sp. Uncharacterized protein y4fD (NGR_a03770)

SKU:CSB-CF347600RKX

Regular price $1,827.00 USD
Regular price Sale price $1,827.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:P55442

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTQETLRKLWITLAILTLVVMINIHGSTQKSDFALIIKLPIELKFDGELTREAYAVHGMR FFALFFWLVPFLAVYHAKRSSGSASEAFPFRLLDIEPRSRPGKWVQGIAFVVLICLPLLT AIHLWRIVVGMQVCQHVSNALVNCADIWSRPVNAGPWDDTYRLANWGPTYDPLVEPVLAV ILTAVSVYLTLRLVIEMRRAGSRPVATGNTPAEPITTSVT

Protein Names:Recommended name: Uncharacterized protein y4fD

Gene Names:Ordered Locus Names:NGR_a03770 ORF Names:y4fD

Expression Region:1-220

Sequence Info:full length protein

View full details