Gene Bio Systems
Recombinant Rhizobium radiobacter Protein virB2(virB2)
Recombinant Rhizobium radiobacter Protein virB2(virB2)
SKU:CSB-CF362791RKV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Uniprot NO.:P09776
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRRSLGLVAGVVGGIVIMFGASFLGQTLTGGS
Protein Names:Recommended name: Protein virB2
Gene Names:Name:virB2
Expression Region:20-121
Sequence Info:full length protein
