Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti Protein exoD(exoD)

Recombinant Rhizobium meliloti Protein exoD(exoD)

SKU:CSB-CF700601RKU

Regular price $1,913.00 USD
Regular price Sale price $1,913.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q52923

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVCQARFGVKNASRGHRMERPQTVKGKIMAVEFGDSQRSLSDTLTGMIASIRGNTITLRE LMIEIGEQGFLLLCALLTLPFLIPVSIPGVSTVFGAAIILISLAITLNRMPWLPKRILDR EIATEKLVPTLRKGAALVSKLDRYVRPRLNFLTEGALMNRFNGLMIMAGGVLLMFPLGLI PLSNTLPGIAILLLSLGIIQRDGLMVAGGYFFLVATTVYFAVLGYAAFAAGQGLSHFFVS

Protein Names:Recommended name: Protein exoD

Gene Names:Name:exoD Ordered Locus Names:R00273 ORF Names:SMc00353

Expression Region:1-240

Sequence Info:full length protein

View full details