Gene Bio Systems
Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit C(phaC)
Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit C(phaC)
SKU:CSB-CF700604RKU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Uniprot NO.:Q52980
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELILSAGIGTLTASGVYLLLRPRTYQVIIGLSLLSFAVNLFIFGMGRLRVNAPPILDPG GVGDLARYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGFTGTDHVDGREQRGD
Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit C Alternative name(s): pH adaptation potassium efflux system protein C Short name= Pha system subunit C
Gene Names:Name:phaC Synonyms:phaC1 Ordered Locus Names:R02911 ORF Names:SMc03180
Expression Region:1-115
Sequence Info:full length protein