Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti PhaF2 protein(phaF2)

Recombinant Rhizobium meliloti PhaF2 protein(phaF2)

SKU:CSB-CF706591RKU

Regular price $1,707.00 USD
Regular price Sale price $1,707.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:Q52965

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPAAVLSAASGVALVLLSLALLLTVLRIIRGPTLPDRVLGLDMLVAIAIGLIAVIAVRT GFYLYIDIAIALGLVGFLATVAFARFILARGLSPERRTPGTTEIPQAKPRPSQAGRRKRK GAR

Protein Names:Recommended name: PhaF2 protein

Gene Names:Name:phaF2 Ordered Locus Names:R00997 ORF Names:SMc00056

Expression Region:1-123

Sequence Info:full length protein

View full details