Gene Bio Systems
Recombinant Rhizobium meliloti PhaF2 protein(phaF2)
Recombinant Rhizobium meliloti PhaF2 protein(phaF2)
SKU:CSB-CF706591RKU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Uniprot NO.:Q52965
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPAAVLSAASGVALVLLSLALLLTVLRIIRGPTLPDRVLGLDMLVAIAIGLIAVIAVRT GFYLYIDIAIALGLVGFLATVAFARFILARGLSPERRTPGTTEIPQAKPRPSQAGRRKRK GAR
Protein Names:Recommended name: PhaF2 protein
Gene Names:Name:phaF2 Ordered Locus Names:R00997 ORF Names:SMc00056
Expression Region:1-123
Sequence Info:full length protein
