Skip to product information
1 of 1

GeneBio Systems

Recombinant Rhizobium meliloti Nodulation protein H (nodH)

Recombinant Rhizobium meliloti Nodulation protein H (nodH)

SKU:P06237

Regular price $1,068.00 USD
Regular price Sale price $1,068.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P06237

Gene Names: nodH

Alternative Name(s): (Host-specificity of nodulation protein D)

Abbreviation: Recombinant Rhizobium meliloti nodH protein

Organism: Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)

Source: E.coli

Expression Region: 1-247aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MTHSTLPPRPFAILAMRRTGTHYLEELVNEHPNVLSNGELLNTYDTNWPDKERLLLSDRELLERACWRYPPHSDKKVTHVGCKINEPQFQERPSFFAELTAWPGLKVILVIRRNTLESLRSFVQARQTRQWLQFKSDSSAPPPPVMLPFATCEAYFKAADDFHARVVNAFDSSRIRLIEYERLLRDPVPCVATVLDFLGAPALQLADRGILRRQETRPLDQTVRNFHELRVHFANGPYARFFELAND

MW: 36.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Required for the formation of sulfated nod factor. Proposed to transfer activated sulfate (PAPS) to a N-acetylglucosamine of the nod factor.

Reference: "Organization, structure and symbiotic function of Rhizobium meliloti nodulation genes determining host specificity for alfalfa." Horvath B., Kondorosi E., John M., Schmidt J., Toeroek I., Gyoergypal Z., Barabas I., Wieneke U., Schell J., Kondorosi A. Cell 46: 335-343(1986)

Function:

View full details