Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium loti UPF0314 protein mll5005(mll5005)

Recombinant Rhizobium loti UPF0314 protein mll5005(mll5005)

SKU:CSB-CF839668RCU

Regular price $1,800.00 USD
Regular price Sale price $1,800.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti)

Uniprot NO.:Q98CU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKPAADDGYSAYEDSWRMGLLLVLGLLIFQAGALYGMGRTPICTCGYVKLWHGVVNSSE NSQHIADWYTFSHIIHGFLFYALVRFLFPRSPIGLRLAFAVLIEGGWELLENSPFIIDRY RAGTISLDYYGDSIINSVSDTLAMVLGFVMARRLPIWVIVSLAILFELGTGYLIRDNLTL NVIMLLHPFEAIKQWQSGI

Protein Names:Recommended name: UPF0314 protein mll5005

Gene Names:Ordered Locus Names:mll5005

Expression Region:1-199

Sequence Info:full length protein

View full details