Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium leguminosarum bv. viciae (strain 3841)
Uniprot NO.:Q1MKT0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGGHARGPFPPFDSTTYASQLLW LVITFGVFYLLMQKVIAPRIGAILDQRHTRLSQDVEEAGRLKAEADAAVRTYEGELAAAR AKSNAIGSAARDAAKAKAEQDRRAVEATLSEKIKAAEVRIGEIKAKAFADVGAIAEETAA AVIDQLIGGTVAKADVAAAVAAAKKEV
Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'
Gene Names:Name:atpG Ordered Locus Names:RL0927
Expression Region:1-207
Sequence Info:full length protein