Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium etli Biotin transporter BioY(bioY)

Recombinant Rhizobium etli Biotin transporter BioY(bioY)

SKU:CSB-CF645586RKK

Regular price $1,789.00 USD
Regular price Sale price $1,789.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium etli (strain CFN 42 / ATCC 51251)

Uniprot NO.:Q2KBP7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTRDLVLTALFAAIIVALGLLPPISLGFIPVPITAQSLGVMMAGVVLGARRGAIAVLIV LLLVAIGLPVLSGGRGGLAIFASPTAGFLVGWIFGAFVTGYLSERLVNHGQSGLVQTVSF FLAAMIGGIVVLYAFGITYLATVAGLGFTKAFVGSMAFIPGDVIKAVVAALLGRAVMVGY PLLPARA

Protein Names:Recommended name: Biotin transporter BioY Alternative name(s): Biotin ECF transporter S component BioY

Gene Names:Name:bioY Ordered Locus Names:RHE_CH00928

Expression Region:1-187

Sequence Info:full length protein

View full details