Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Voltage-dependent calcium channel gamma-like subunit(Tmem37)

Recombinant Rat Voltage-dependent calcium channel gamma-like subunit(Tmem37)

SKU:CSB-CF840873RA

Regular price $1,815.00 USD
Regular price Sale price $1,815.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q8VHW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAIGAQAYKLLGPKRPHRSFFESFIRTLIIVCTALAVVLSSVSICDGHWLLVEDRLFGL WYFCTISNHSEPHCLRDLSQAQVPGVAVGMGLARSVAAMAVVAAIFGLELLIVSQVCEDV RSRSKWAIGSYLLLVAFILSSGGLLTFIILLKNQITLMGFTLMFWCEFTASFLFFLNATS GLHINSLTRSPPAGTLAYRKQGYDGTSLI

Protein Names:Recommended name: Voltage-dependent calcium channel gamma-like subunit Alternative name(s): Neuronal voltage-gated calcium channel gamma-like subunit Transmembrane protein 37

Gene Names:Name:Tmem37 Synonyms:Pr1

Expression Region:1-209

Sequence Info:full length protein

View full details