Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Vesicle-associated membrane protein 3(Vamp3)

Recombinant Rat Vesicle-associated membrane protein 3(Vamp3)

SKU:CSB-CF025782RA

Regular price $1,684.00 USD
Regular price Sale price $1,684.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P63025

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS

Protein Names:Recommended name: Vesicle-associated membrane protein 3 Short name= VAMP-3 Alternative name(s): Cellubrevin Short name= CEB Synaptobrevin-3

Gene Names:Name:Vamp3 Synonyms:Syb3

Expression Region:1-103

Sequence Info:full length protein

View full details