Recombinant Rat Vasopressin V1b receptor(Avpr1b),partial

SKU: CSB-RP156394r(A4)

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P48974

Gene Names: Avpr1b

Organism: Rattus norvegicus (Rat)

AA Sequence: NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF

Expression Region: 343-425aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13 kDa

Alternative Name(s): AVPR V1bAVPR V3Antidiuretic hormone receptor 1bVasopressin V3 receptor

Relevance: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst.

Reference: Extrapituitary expression of the rat V1b vasopressin receptor gene.Lolait S.J., O'Carroll A.-M., Mahan L.C., Felder C.C., Button D.C., Young W.S. III, Mezey E., Brownstein M.J.Proc. Natl. Acad. Sci. U.S.A. 92:6783-6787(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.