Recombinant Rat V-type proton ATPase subunit e 1(Atp6v0e1)

SKU: CSB-CF755280RA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q794C0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLN PLFGPQLKNETIWYLKYHWP

Protein Names:Recommended name: V-type proton ATPase subunit e 1 Short name= V-ATPase subunit e 1 Alternative name(s): D-serine-regulated transcript 1 protein Short name= DSR-1 V-ATPase 9.2 kDa membrane accessory protein V-ATPase M9.2 subu

Gene Names:Name:Atp6v0e1 Synonyms:Atp6v0e, Dsr1

Expression Region:2-81

Sequence Info:full length protein