Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Toll-like receptor 4(Tlr4),partial

Recombinant Rat Toll-like receptor 4(Tlr4),partial

SKU:CSB-CF023603RA

Regular price $871.00 USD
Regular price Sale price $871.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Immunology

Uniprot ID: Q9QX05

Gene Names: Tlr4

Organism: Rattus norvegicus (Rat)

AA Sequence: NPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDLSFNPLKILRSYSFTNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGSFSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVDLSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSNVLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIYNLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNREDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLEELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNSFKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQLYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVNVEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVS

Expression Region: 26-638aa

Sequence Info: Extracellular Domain

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 90.2 kDa

Alternative Name(s): CD_antigen: CD284

Relevance: Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate. In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL

Reference: "Toll-like receptor 4: the missing link of the cerebral innate immune response triggered by circulating gram-negative bacterial cell wall components."Laflamme N., Rivest S.FASEB J. 15:155-163(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details