Gene Bio Systems
Recombinant Rat TGF-beta receptor type-2(Tgfbr2), partial
Recombinant Rat TGF-beta receptor type-2(Tgfbr2), partial
SKU:CSB-BP023452RA1
Couldn't load pickup availability
Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 25-35 working days
Research Topic: Signal Transduction
Uniprot ID: P38438
Gene Names: Tgfbr2
Organism: Rattus norvegicus (Rat)
AA Sequence: IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ
Expression Region: 24-166aa
Sequence Info: Partial
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 20 kDa
Alternative Name(s): TGF-beta type II receptor Transforming growth factor-beta receptor type II
Relevance: Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways
Reference: "Elevation of expression of Smads 2, 3, and 4, decorin and TGF-beta in the chronic phase of myocardial infarct scar healing." Hao J., Ju H., Zhao S., Junaid A., Scammell-La Fleur T., Dixon I.M. J. Mol. Cell. Cardiol. 31:667-678(1999)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
