Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Tetraspanin-13(Tspan13)

Recombinant Rat Tetraspanin-13(Tspan13)

SKU:CSB-CF682905RA

Regular price $1,807.00 USD
Regular price Sale price $1,807.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q5FVL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVCGGFSCSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNREQQGQLLEVGWNNTASARN DIQRNLNCCGFRNYNPNDTCPASCAKSNQKCSSCAPIIGEYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL

Protein Names:Recommended name: Tetraspanin-13 Short name= Tspan-13 Alternative name(s): Transmembrane 4 superfamily member 13

Gene Names:Name:Tspan13 Synonyms:Tm4sf13

Expression Region:1-204

Sequence Info:full length protein

View full details