Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Tail-anchored protein insertion receptor WRB(Wrb)

Recombinant Rat Tail-anchored protein insertion receptor WRB(Wrb)

SKU:CSB-CF740730RA

Regular price $1,771.00 USD
Regular price Sale price $1,771.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q6P6S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSASETDRWAWLLVLCFVFGCNVLRILLPTLSSFISRVLQKDAEQESQMRAEIQSMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYVLQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGIGVTCWILVCNKVVAIILHPFS

Protein Names:Recommended name: Tail-anchored protein insertion receptor WRB Alternative name(s): Tryptophan-rich basic protein Short name= WRB

Gene Names:Name:Wrb

Expression Region:1-174

Sequence Info:full length protein

View full details