Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Synaptotagmin-15(Syt15)

Recombinant Rat Synaptotagmin-15(Syt15)

SKU:CSB-CF023035RA

Regular price $2,136.00 USD
Regular price Sale price $2,136.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P59926

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEQLALVIGCIIGGLLLLIGISCCLWKRLCTTFTYEELPETADTATSSSFSKKEERPCRYAGIPSVRLPSVPFVVPPSHQGRDWVRLHGGDWAVAPQDPCPVPEHITCTSSPAAGQTSLPLCVMGSINPELYKSSEDVSEAGFPDGCLGRLWFSVEYQQESERLLVDLIKAQHLQVPAETCSTLVKLHLLPDKRRFLQSKAKRKTCNPQFDESFIFQVSSKSVAQRVLKFSVYHINKQRKHQLLGQVLFPLKNETLAGDRHRVIWRDLEAENLEPLSEFGDLQFCLSYNDYLSRLTVVVLRAKGLQLQEDRGVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKADANELDTASLSLVVLQITEGDKSYPLGRVVVGPYMYTRGKELEHWNEMLRKPKELVKRWHALCRPMEP

Protein Names:Recommended name: Synaptotagmin-15 Alternative name(s): Synaptotagmin XV Short name= SytXV

Gene Names:Name:Syt15 Synonyms:Sytxv

Expression Region:1-422

Sequence Info:full length protein

View full details