Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Prolactin-inducible protein homolog(Pip)

Recombinant Rat Prolactin-inducible protein homolog(Pip)

SKU:CSB-YP530344RA

Regular price $1,055.00 USD
Regular price Sale price $1,055.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: O70417

Gene Names: Pip

Organism: Rattus norvegicus (Rat)

AA Sequence: QDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN

Expression Region: 27-146aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.7 kDa

Alternative Name(s): Prolactin-induced protein

Relevance:

Reference: Expression of gross cystic disease fluid protein-15/Prolactin-inducible protein in rat salivary glands.Mirels L., Hand A.R., Branin H.J.J. Histochem. Cytochem. 46:1061-1071(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details