Gene Bio Systems
Recombinant Rat Pre T-cell antigen receptor alpha(Ptcra)
Recombinant Rat Pre T-cell antigen receptor alpha(Ptcra)
SKU:CSB-CF018961RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P0C6B3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LPSGIAGTPFPSLAPPVTLLVDGRRHTLVVCLVLDAAPPGLDSLVWFSGGNGSALDAFTYGPSPAPDGTWTSLGQLSLSSEELEAWEPLVCHTRPAAGGLNRSTHPLQLSGEEASTDRTCPQETLRGTQRQVLRLSVLRLLLFKLLLLDVFLTCSRLCVLAGQHLLPPPSSKQAPASTHQSWT
Protein Names:Recommended name: Pre T-cell antigen receptor alpha Short name= pT-alpha Short name= pTa Alternative name(s): pT-alpha-TCR
Gene Names:Name:Ptcra
Expression Region:17-199
Sequence Info:full length protein
