Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Potassium-transporting ATPase subunit beta(Atp4b)

Recombinant Rat Potassium-transporting ATPase subunit beta(Atp4b)

SKU:CSB-CF002343RA

Regular price $1,976.00 USD
Regular price Sale price $1,976.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P18598

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAALQEKKSCSQRMAEFRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIDPYTPDYQDQLKSPGVTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGYTPASQQDSINCSSEKYFFQETFSAPNHTKFSCKFTADMLQNCSGLVDPSFGFEEGKPCFIIKMNRIVKFLPSNNTAPRVDCTFQDDPQKPRKDIEPLQVQYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKLTIQK

Protein Names:Recommended name: Potassium-transporting ATPase subunit beta Alternative name(s): Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain

Gene Names:Name:Atp4b

Expression Region:1-294

Sequence Info:full length protein

View full details