Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat NKG2-D type II integral membrane protein(Klrk1)

Recombinant Rat NKG2-D type II integral membrane protein(Klrk1)

SKU:CSB-CF012474RA

Regular price $1,876.00 USD
Regular price Sale price $1,876.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O70215

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKCHNYDLKPAKWDTSQEHQKQRSALPTSRPGENGIIRRRSSIEELKISPLFVVRVLVAAMTIRFTVITLTWLAVFITLLCNKEVSVSSREGYCGPCPNDWICHRNNCYQFFNENKAWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQSPANGSWQWEDGSSLSPNELTLVKTPSGTCAVYGSSFKAYTEDCSNPNTYICMKRAV

Protein Names:Recommended name: NKG2-D type II integral membrane protein Alternative name(s): Killer cell lectin-like receptor subfamily K member 1 NK cell receptor D NK lectin-like receptor Short name= NKLLR NKG2-D-activating NK receptor NKR-P2 CD_antigen= CD314

Gene Names:Name:Klrk1 Synonyms:Nkg2d, Nkrp2

Expression Region:1-215

Sequence Info:full length protein

View full details