Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Mitochondrial fission 1 protein(Fis1)

Recombinant Rat Mitochondrial fission 1 protein(Fis1)

SKU:CSB-CF008684RA

Regular price $1,795.00 USD
Regular price Sale price $1,795.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P84817

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Protein Names:Recommended name: Mitochondrial fission 1 protein Alternative name(s): FIS1 homolog Short name= rFis1 Tetratricopeptide repeat protein 11 Short name= TPR repeat protein 11

Gene Names:Name:Fis1 Synonyms:Ttc11

Expression Region:1-152

Sequence Info:full length protein

View full details