Gene Bio Systems
Recombinant Rat Mitochondrial fission 1 protein(Fis1)
Recombinant Rat Mitochondrial fission 1 protein(Fis1)
SKU:CSB-CF008684RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P84817
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
Protein Names:Recommended name: Mitochondrial fission 1 protein Alternative name(s): FIS1 homolog Short name= rFis1 Tetratricopeptide repeat protein 11 Short name= TPR repeat protein 11
Gene Names:Name:Fis1 Synonyms:Ttc11
Expression Region:1-152
Sequence Info:full length protein
