Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Linker for activation of T-cells family member 1(Lat)

Recombinant Rat Linker for activation of T-cells family member 1(Lat)

SKU:CSB-CF012767RA

Regular price $1,855.00 USD
Regular price Sale price $1,855.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:O70601

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEADALSPVELGLLLLPFVVMLLAALCVRCRELPASYDSASTESLYPRSILIKPPQITVPRTPATSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSRQNSDDANSVASYENQEPARKNVDEDEDEDDYPEGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSMESCEDYVNVPESEESAEASLDGSREYVNVSQDAQPVIRAELASVTSQEVEDEEEEDVDGEEAPDYENLQELN

Protein Names:Recommended name: Linker for activation of T-cells family member 1 Alternative name(s): 36 kDa phospho-tyrosine adapter protein Short name= pp36 p36-38

Gene Names:Name:Lat

Expression Region:1-241

Sequence Info:full length protein

View full details