Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Kit ligand(Kitlg)

Recombinant Rat Kit ligand(Kitlg)

SKU:CSB-CF012376RA

Regular price $1,918.00 USD
Regular price Sale price $1,918.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P21581

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

Protein Names:Recommended name: Kit ligand Alternative name(s): Hematopoietic growth factor KL Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG

Gene Names:Name:Kitlg Synonyms:Kitl, Mgf

Expression Region:26-273

Sequence Info:full length protein

View full details