Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)

Recombinant Rat High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)

SKU:CSB-CF008533RA

Regular price $1,690.00 USD
Regular price Sale price $1,690.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P20411

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKSDAVYTGLNTRNQETYETLKHEKPPQ

Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit gamma Alternative name(s): Fc receptor gamma-chain Short name= FcRgamma Fc-epsilon RI-gamma IgE Fc receptor subunit gamma Short name= FceRI gamma

Gene Names:Name:Fcer1g Synonyms:Fce1g

Expression Region:19-86

Sequence Info:full length protein

View full details