Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat High affinity copper uptake protein 1(Slc31a1)

Recombinant Rat High affinity copper uptake protein 1(Slc31a1)

SKU:CSB-CF862390RA

Regular price $1,785.00 USD
Regular price Sale price $1,785.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q9JK41

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRMNHMEMHHMGMNHTDDNITMPPHQHPTTSASHSHEMMMPMTFYFGFKNVDLLFSSLVI NTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGTILMETHKTV GQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVV DITEHCH

Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= rCTR1 Liver regeneration-related protein LRRGT00200 Solute carrier family 31 member 1

Gene Names:Name:Slc31a1 Synonyms:Copt1, Ctr1

Expression Region:1-187

Sequence Info:full length protein

View full details