Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r), partial

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r), partial

SKU:CSB-BP009514RA1-GB

Regular price $709.00 USD
Regular price Sale price $709.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Neuroscience

Uniprot ID: P32301

Gene Names: Glp1r

Organism: Rattus norvegicus (Rat)

AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Expression Region: 22-135aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

MW: 15.6 kDa

Alternative Name(s): Glpr

Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1

Reference: "Exendin-4 stimulates both beta-cell replication and neogenesis, resulting in increased beta-cell mass and improved glucose tolerance in diabetic rats." Xu G., Stoffers D.A., Habener J.F., Bonner-Weir S. Diabetes 48:2270-2276(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details