Gene Bio Systems
Recombinant Rat Gamma-secretase subunit PEN-2(Psenen)
Recombinant Rat Gamma-secretase subunit PEN-2(Psenen)
SKU:CSB-CF757686RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q6QI68
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
Protein Names:Recommended name: Gamma-secretase subunit PEN-2 Alternative name(s): Liver regeneration-related protein LRRGT00140 Presenilin enhancer protein 2
Gene Names:Name:Psenen
Expression Region:1-101
Sequence Info:full length protein
