Recombinant Rat Complement C3(C3) ,partial

SKU: CSB-YP360475RA

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: P01026

Gene Names: C3

Organism: Rattus norvegicus (Rat)

AA Sequence: SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL

Expression Region: 671-746aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11 kDa

Alternative Name(s): Neutrophil chemotactic factor-2

Relevance: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.

Reference: "Complement component C3-derived neutrophil chemotactic factors purified from exudate of rat carrageenin-induced inflammation."Nakagawa H., Komorita N.Biochem. Biophys. Res. Commun. 194:1181-1187(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.