Recombinant Rat Collagen alpha-1(I) chain,partial

SKU: CSB-YP005727RA

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P02454

Gene Names: Col1a1

Organism: Rattus norvegicus (Rat)

AA Sequence: QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Expression Region: 955-1207aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 25.4 kDa

Alternative Name(s): Alpha-1 type I collagen

Relevance: Type I collagen is a mber of group I collagen (fibrillar forming collagen).

Reference: Expression of collagen alpha1(I) mRNA variants during tooth and bone formation in the rat.Brandsten C., Lundmark C., Christersson C., Hammarstroem L., Wurtz T.J. Dent. Res. 78:11-19(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.