Recombinant Rat Asialoglycoprotein receptor 1(Asgr1),partial

Recombinant Rat Asialoglycoprotein receptor 1(Asgr1),partial

CSB-EP002207RA1
Regular price
$899.00 USD
Sale price
$899.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:P02706

Gene Names:Asgr1

Organism:Rattus norvegicus (Rat)

AA Sequence:QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN

Expression Region:61-284aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-tagged

MW:30.1 kDa

Alternative Name(s):Asialoglycoprotein receptor 1(ASGP-R 1)(ASGPR 1)(Hepatic lectin 1)(HL-1)(rHL-1)

Relevance:Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Reference:"Fatty acylation of the rat and human asialoglycoprotein receptors. A conserved cytoplasmic cysteine residue is acylated in all receptor subunits." Zeng F.Y., Weigel P.H. J. Biol. Chem. 271:32454-32460(1996)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

You may also like

  • Recombinant Human Asialoglycoprotein receptor 1(ASGR1),partial
    Regular price
    $609.00 USD
    Sale price
    $609.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Asialoglycoprotein receptor 1(Asgr1),partial
    Regular price
    $778.00 USD
    Sale price
    $778.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2),Partial
    Regular price
    $778.00 USD
    Sale price
    $778.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Asialoglycoprotein receptor 1(Asgr1)
    Regular price
    $1,403.00 USD
    Sale price
    $1,403.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share