Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Apolipoprotein C-III(Apoc3)

Recombinant Rat Apolipoprotein C-III(Apoc3)

SKU:CSB-YP001933RA

Regular price $959.00 USD
Regular price Sale price $959.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P06759

Gene Names: Apoc3

Organism: Rattus norvegicus (Rat)

AA Sequence: DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Expression Region: 21-101aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11 kDa

Alternative Name(s): Apolipoprotein C3

Relevance: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Reference: Linkage, evolution, and expression of the rat apolipoprotein A-I, C-III, and A-IV genes.Haddad I.A., Ordovas J.M., Fitzpatrick T., Karathanasis S.K.J. Biol. Chem. 261:13268-13277(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details