Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Anionic trypsin-2(Prss2)

Recombinant Rat Anionic trypsin-2(Prss2)

SKU:CSB-YP018814RA

Regular price $1,128.00 USD
Regular price Sale price $1,128.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cell Biology

Uniprot ID:P00763

Gene Names:Prss2

Organism:Rattus norvegicus (Rat)

AA Sequence:IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Expression Region:24-246aa

Sequence Info:Full Length of Mature Protein

Source:Yeast

Tag Info:N-terminal 6xHis-tagged

MW:25.3 kDa

Alternative Name(s):Anionic trypsin II (Pretrypsinogen II) (Serine protease 2) (Try2)

Relevance:

Reference:"The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity." Pasternak A., White A., Jeffery C.J., Medina N., Cahoon M., Ringe D., Hedstrom L. Protein Sci. 10:1331-1342(2001)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:Secreted, extracellular space

Protein Families:Peptidase S1 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=1584

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:25052

STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000060784

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details