Gene Bio Systems
Recombinant Rat Activator of apoptosis harakiri(Hrk)
Recombinant Rat Activator of apoptosis harakiri(Hrk)
SKU:CSB-CF010741RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P62817
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLP ALLPALRARWPWLCAAAQVAALAAWLLGRRSA
Protein Names:Recommended name: Activator of apoptosis harakiri Alternative name(s): BH3-interacting domain-containing protein 3 Neuronal death protein DP5
Gene Names:Name:Hrk Synonyms:Bid3, Dp5
Expression Region:1-92
Sequence Info:Full length protein
