Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ralstonia solanacearum UPF0060 membrane protein RSp1275(RSp1275)

Recombinant Ralstonia solanacearum UPF0060 membrane protein RSp1275(RSp1275)

SKU:CSB-CF834927RAR

Regular price $1,693.00 USD
Regular price Sale price $1,693.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)

Uniprot NO.:Q8XQF2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEYLRIAFLFALTALAEIVGCYLPWLVLRQAKSAWLLMPAALSLALFAWLLTLHPTAAGR TYAAYGGMYIAVALAWLRVVDGATLTRWDIGGAAIALAGMAVIALQPQPT

Protein Names:Recommended name: UPF0060 membrane protein RSp1275

Gene Names:Ordered Locus Names:RSp1275 ORF Names:RS05320

Expression Region:1-110

Sequence Info:full length protein

View full details