Gene Bio Systems
Recombinant Rabbit Zona pellucida sperm-binding protein 4(ZP4)
Recombinant Rabbit Zona pellucida sperm-binding protein 4(ZP4)
SKU:CSB-CF027122RB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Oryctolagus cuniculus (Rabbit)
Uniprot NO.:Q00193
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:KQPKPETPTDPGVLHCRPWNFKFTINFQNQETGSSPVLVTWDNQGRLHRLQNDTDCGTRVGEGPGPSVVLEANYSSCYVTESEPYYVMLVGVEEVDAAGQNLVTKQQLLKCPMHLPAPDAGLCDSVPVQDRLPCATAPISQEDCEELGCCHSSEEVNACYYGNTVTSHCTQEGHFSIAVSRNVSSPPLHLDSVHLVFGNDSECQPVVATRAFVLFLFPFTACGTTRQITGDRAIYENELLATREVRTWSRGSITRDSIFRLRVSCSYSISSSALPVDMHVLTLPPPLPETQPGPLTVVLQIAKDKDYHSYYTMDDYPVVKLLRDPIYVDVSILYRTDPYLGLRLHQCWATPRTNPLYQPQWPILVKGCPYTGDNYQTQLIPVQEAFDLPFPSHHQRFSISTFSFLDSSVAKEALKGPIYLHCSVSVCQPTGTQSCTVTCPIDSRRRNSDINFQNSTANISSKGPMI
Protein Names:Recommended name: Zona pellucida sperm-binding protein 4 Alternative name(s): RC55 Zona pellucida glycoprotein 4 Short name= Zp-4 Zona pellucida glycoprotein X Short name= Zp-X Zona pellucida protein B Cleaved into the following chain: 1. Processed zona pellucida sperm-binding protein 4
Gene Names:Name:ZP4 Synonyms:ZPB, ZPX
Expression Region:25-466
Sequence Info:full length protein
