Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Zona pellucida sperm-binding protein 4(ZP4)

Recombinant Rabbit Zona pellucida sperm-binding protein 4(ZP4)

SKU:CSB-CF027122RB

Regular price $2,161.00 USD
Regular price Sale price $2,161.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:Q00193

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KQPKPETPTDPGVLHCRPWNFKFTINFQNQETGSSPVLVTWDNQGRLHRLQNDTDCGTRVGEGPGPSVVLEANYSSCYVTESEPYYVMLVGVEEVDAAGQNLVTKQQLLKCPMHLPAPDAGLCDSVPVQDRLPCATAPISQEDCEELGCCHSSEEVNACYYGNTVTSHCTQEGHFSIAVSRNVSSPPLHLDSVHLVFGNDSECQPVVATRAFVLFLFPFTACGTTRQITGDRAIYENELLATREVRTWSRGSITRDSIFRLRVSCSYSISSSALPVDMHVLTLPPPLPETQPGPLTVVLQIAKDKDYHSYYTMDDYPVVKLLRDPIYVDVSILYRTDPYLGLRLHQCWATPRTNPLYQPQWPILVKGCPYTGDNYQTQLIPVQEAFDLPFPSHHQRFSISTFSFLDSSVAKEALKGPIYLHCSVSVCQPTGTQSCTVTCPIDSRRRNSDINFQNSTANISSKGPMI

Protein Names:Recommended name: Zona pellucida sperm-binding protein 4 Alternative name(s): RC55 Zona pellucida glycoprotein 4 Short name= Zp-4 Zona pellucida glycoprotein X Short name= Zp-X Zona pellucida protein B Cleaved into the following chain: 1. Processed zona pellucida sperm-binding protein 4

Gene Names:Name:ZP4 Synonyms:ZPB, ZPX

Expression Region:25-466

Sequence Info:full length protein

View full details