GeneBio Systems
Recombinant Rabbit Thymic stromal lymphopoietin (TSLP), partial
Recombinant Rabbit Thymic stromal lymphopoietin (TSLP), partial
SKU:G1TYN9
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Immunology
Uniprot ID: G1TYN9
Gene Names: TSLP
Alternative Name(s):
Abbreviation: Recombinant Rabbit TSLP protein, partial
Organism: Oryctolagus cuniculus (Rabbit)
Source: E.coli
Expression Region: 29-149aa
Protein Length: Partial
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: HSFTNCDFGKIRKKYEKIIYPALEKYMQGVSKETFSLKKIYCLSTIERDTFTPTPGCASLPTADFARKTWAVFALRCPGYSRVQINSLQEVKKGEDTTNNCLEKASHLLGLWRRFSRISEE
MW: 26.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "A high-resolution map of human evolutionary constraint using 29 mammals." Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J. Kellis M. Nature 478: 476-482(2011)
Function:
