Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryctolagus cuniculus (Rabbit)
Uniprot NO.:O77770
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EVVRKTVPTTTKRPHSGPRGNPGPARMRNDSRPSVQEDSEPFNPDNPYHQEGESMTFDPR LDHEGICCIECRRSYTHCQKICEPLGGYNPWPYNYQGCRSACRVVMPCSWWVARILGMV
Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name= ChM-I
Gene Names:Name:LECT1 Synonyms:CHMI
Expression Region:215-333
Sequence Info:Full length protein