Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Anion exchange transporter(SLC26A7)

Recombinant Rabbit Anion exchange transporter(SLC26A7)

SKU:CSB-CF816824RB

Regular price $1,714.00 USD
Regular price Sale price $1,714.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:Q8HY59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LFSFKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPRGIPPPRAP PMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFLFCI PSAAAMGR

Protein Names:Recommended name: Anion exchange transporter Alternative name(s): Solute carrier family 26 member 7

Gene Names:Name:SLC26A7

Expression Region:1-128

Sequence Info:full length protein

View full details